PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00258g00225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family G2-like
Protein Properties Length: 515aa    MW: 58071.7 Da    PI: 6.2837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00258g00225.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-31237291155
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               k+r+rWt++LH+rFv++v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Peaxi162Scf00258g00225.1 237 KTRIRWTQDLHDRFVDCVTRLGGADKATPKAILKLMESEGLTIFHVKSHLQKYRN 291
                               68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.788234294IPR017930Myb domain
SuperFamilySSF466896.45E-16235291IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28235292IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-24237292IPR006447Myb domain, plants
PfamPF002492.1E-7241290IPR001005SANT/Myb domain
PfamPF143791.9E-21321368IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143797.8E-13430475IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MSIQREILQQ NYKFASDYTL ERAAMHVPKQ SSSYMGFSLP PATSVEEVCE QQQQQQQSFL  60
PNANSSSSNS TIIGRIGSPS SAFFATERYL GLPQYDDHQD NSSQLSKNYD FQVQSSYSQQ  120
QCGNGFLTDS QAEALPDFHP KISLPPFMRS QFSTSQPFSP FSSLSEKERI MHLKRKLLGE  180
FDSASIPCEV NQDCSLSHNL CGNHLAHMMQ QSAGMPSGCP SASSNNSASS GGSVSNKTRI  240
RWTQDLHDRF VDCVTRLGGA DKATPKAILK LMESEGLTIF HVKSHLQKYR NAKYIPEPTE  300
GKSEKRSSPN NVTQIDSKTG IQIKEALQMQ LEVQRRLHEQ LEIQRKLQLR IEEQGKQLKM  360
IFDQQQKTTR SLLDTQNSSP GDDPSTCLYD DIEILVAECS DNTSFPSKIS ESEKRDSPSN  420
VTQIDNKTGM QIKEALQMQL DAQRLIHEEV ERKLQLRIEE QSKKLKMIFD QQQKTNWSLL  480
EAQNSSISSR GNDPSTQHDE IESFVAERSE NAHLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603787.10.0PREDICTED: uncharacterized protein LOC104098688
RefseqXP_016456105.10.0PREDICTED: uncharacterized protein LOC107780100
TrEMBLK4D2B41e-146K4D2B4_SOLLC; Uncharacterized protein
STRINGSolyc10g078720.1.11e-146(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-68G2-like family protein